Skoči na glavni sadržaj

Izvorni znanstveni članak

https://doi.org/10.17113/ftb.63.03.25.8512

Brza identifikacija vrsta ribe u sirovom i toplinski obrađenom ribljem mesu pomoću proteinskih biljega specifičnih za vrstu

Alena Meledina orcid id orcid.org/0000-0001-6353-8578 ; Department of Biochemistry and Microbiology, University of Chemistry and Technology, Prague, Technicka 3, 166 28 Prague 6, Czech Republic
David Straka orcid id orcid.org/0000-0002-4877-4393 ; Department of Biochemistry and Microbiology, University of Chemistry and Technology, Prague, Technicka 3, 166 28 Prague 6, Czech Republic
Filip Soucek ; Department of Biochemistry and Microbiology, University of Chemistry and Technology, Prague, Technicka 3, 166 28 Prague 6, Czech Republic
Tatiana Anatolievna Smirnova orcid id orcid.org/0000-0003-2713-0721 ; Department of Biochemistry and Microbiology, University of Chemistry and Technology, Prague, Technicka 3, 166 28 Prague 6, Czech Republic
Stepanka Kuckova orcid id orcid.org/0000-0002-9974-7862 ; Department of Biochemistry and Microbiology, University of Chemistry and Technology, Prague, Technicka 3, 166 28 Prague 6, Czech Republic


Puni tekst: engleski pdf 654 Kb

str. 287-297

preuzimanja: 169

citiraj

Preuzmi JATS datoteku

Prilozi: FTB-63-287-S1.pdf


Sažetak

Pozadina istraživanja. Glavni problem utvrđivanja autentičnosti ribljeg mesa je prvenstveno zavaravajuće označavanje ili zamjena vrsta, primjerice zamjena vrijednih vrsta ribe onima niže vrijednosti ili vrstama koje potječu iz nezakonitog ribolova. Zbog toga se javlja potreba za pronalaskom odgovarajućih analitičkih metoda, koje mogu poslužiti za otkrivanje patvorene hrane.
Eksperimentalni pristup. Svrha je ovoga istraživanja bila odrediti šest vrsta riba — šarana, skušu, štuku, oslića, lososa i pastrvu — na osnovu njihovih razlika u sastavu bjelančevina, pomoću dviju metoda masene spektrometrije. Metoda MALDI-TOF MS (matricom potpomognuta ionizacija laserskom desorpcijom s analizatorom vremena preleta) korištena je za identifikaciju karakterističnih m/z vrijednosti specifičnih za vrstu, u svrhu razlikovanja sirovog i kuhanog ribljeg mesa. Osim toga, metoda LC-ESI-Q-TOF (tekućinska kromatografija spregnuta s elektrosprej ionizacijom uz kvadrupolni analizator mase i vremena preleta) korištena je za određivanje specifičnih aminokiselinskih slijedova u mesu šarana i lososa, odabranim kao modelne vrste.
Rezultati i zaključci. Za svih šest ispitivanih vrsta riba identificirani su jasno prepoznatljivi m/z biljezi specifični za vrstu, što omogućuje njihovo razlikovanje u sirovom i termički obrađenom ribljem mesu. U šaranu i lososu detektirane su stotine peptidnih sekvencija, čime je definirana skupina peptidnih biljega koja omogućuje određivanje vrste ribe i načina obrade ribljeg mesa. Dobiveni rezultati potvrđuju da proteomski pristupi temeljeni na masenoj spektrometriji mogu biti učinkoviti alati za autentifikaciju ribljeg mesa.
Novina i znanstveni doprinos. Ovo istraživanje pokazuje da se za pouzdanu i brzu identifikaciju vrsta riba mogu upotrijebiti dvije komplementarne tehnike masene spektrometrije. Identifikacija specifičnih peptidnih biljega i m/z vrijednosti karakterističnih za pojedine vrste pridonosi unapređenju kontrole autentičnosti hrane, te predstavlja dobru osnovu za učinkovito otkrivanje patvorenog ribljeg mesa.

Ključne riječi

riblje meso; vrste riba; m/z vrijednosti specifične za vrstu; peptidni biljezi; masena spektrometrija; autentifikacija hrane

Hrčak ID:

334814

URI

https://hrcak.srce.hr/334814

Datum izdavanja:

30.9.2025.

Podaci na drugim jezicima: engleski

Posjeta: 1.526 *




INTRODUCTION

The main problem regarding the fish and seafood authenticity seems to be misleading labelling or species substitution (replacing a more expensive fish with a cheaper one). The labelling of the fish species is a mandatory requirement in the vast majority of legislative regulations. Especially in processed products, where visual identification is not possible in some cases, the identity of the animal can be falsified. There is ususally an economic incentive to replace valuable material with species of lower value or species originating from illegal fishing. Another problem is the fact that many species of seafood are sold under a collective name (14).

The methods used to authenticate meat are generally based on DNA or protein analysis. Molecular techniques based on DNA analysis have undergone enormous development in recent decades. They overcome some limitations of methods based on protein analysis, such as protein denaturation during heat treatment of meat, which can lead to changes in the antigenicity of molecules and their electrophoretic mobility (5,6). However, similar challenges can occur with DNA barcoding when distinguishing closely related species. For example, although DNA barcoding of mitochondrial cytochrome c oxidase subunit 1 (COI) successfully identified 14 of 16 freshwater fish species from Lake Wivenhoe (Queensland, Australia), two undifferentiated species from the family Terapontidae, which have identical COI gene sequences, could not be distinguished using this method (7). This highlights a limitation of DNA barcoding in distinguishing closely related species, a problem that may also exist in protein-based methods. Digital polymerase chain reaction (dPCR) and its modified form droplet digital PCR (ddPCR) are the oldest used DNA amplification techniques that use a water-oil emulsion drop system (5,8). Doi et al. (9) used ddPCR for the detection of environmental DNA (eDNA) originating from an invasive fish species – the bluegill sunfish (Lepomis macrochirus). Furthermore, ddPCR has been used to identify and quantify the highly valued silver pomfret (Pampus argenteus), whose adulteration is a serious problem worldwide (10), and also to analyse marine products from cod (Gadus chalcogrammus), which is of great commercial importance (11). PCR analysis with restriction fragment length polymorphism (PCR-RFLP) is the most widely used method for the identification of meat species including fish (1214). This assay has been optimised to distinguish three closely related gadoid fish species: Alaska pollock, Pacific cod and Atlantic cod in commercial seafood products (15). Lin and Hwang (16) successfully identified eight tuna species in canned products using this technique. Species-specific PCR can be used to identify the taxonomic origin of fish meat and seafood products. For example, Kim et al. (17) differentiated three related grouper species: Epinephelus septemfasciatus, E. bruneus and E. akaara. Multiplex PCR is a method that enables simultaneous identification of several species. This technique has been used to distinguish seven Clupeiform species, including several economically important fish such as herring and sardines (18). Real-time PCR has also been used in the authentication of fish meat. The method was developed for the differentiation and quantification of two closely related tuna species (bigeye tuna – Thunnus obesus and yellowfin tuna – Thunnus albacares) in canned products (19). The combination of real-time PCR and multiplex PCR was used for the identification of eight ecologically and economically important freshwater fish species (20).

Traditional protein analysis techniques include immunological, chromatographic, spectroscopic and electrophoretic methods. The U.S. Food and Drug Administration (FDA) maintains the Regulatory fish encyclopaedia (21), which serves as a repository of data on protein analyses for fish identification. Traditional protein methods face challenges due to the denaturation or degradation of proteins that often occurs during sample preparation. This makes these methods generally unsuitable for the identification of proteins in processed meat. However, in some studies, fish species were identified with the enzyme-linked immune sorbent assay (ELISA) using antibodies against muscle proteins. It involved distinguishing canned sardines from other fish such as herring, mackerel, anchovy (22) and identifying individual species of flatfish (23). Red snapper was also identified using this technique (24), and raw and processed grouper meat was distinguished from cheaper fish species (25).

Sodium dodecyl sulphate–polyacrylamide gel electrophoresis (SDS-PAGE) was used by a group of Pineiro et al. (26) to differentiate of 15 species of raw and cooked fish. Also, the combination of SDS-PAGE with isoelectric focusing was successful in the identification of species of unknown samples (27,28). Martinez and Jakobsen (29) used two-dimensional electrophoresis (2-DE) to investigate the authenticity of fish and shrimp and also to assess their freshness using separated myofibrillar proteins. Berrini et al. (30) distinguished four species of fish, which were sold under the same trade name "perch", using a method focusing on sarcoplasmic proteins.

High-performance liquid chromatography (HPLC) methods for determining the type of meat typically rely on analysing protein, peptide or amino acid profiles unique to different types of meat. For instance, 31 fish species were distinguished using HPLC analysis of water-soluble sarcoplasmic muscle proteins (31). However, it was found that heat treatment (cooking) had a relatively significant effect on the quality of the chromatograms (31). Chou et al. (32) developed a method applicable to fresh and cooked meat for the routine discrimination between meat products from 15 common animal species (mammals, birds and fish) based on HPLC with electrochemical detection using copper nanoparticles.

Currently, mass spectrometry (MS) techniques play a key role in the analysis of proteins and peptides in food, including the investigation of the authenticity of meat and meat products. For example, Volta et al. (33) distinguished three freshwater fish meat species (Alosa agone, Coregonus macrophthalmus and Rutilus rutilus) based on the differences in the spectra of muscle tissue using MALDI-TOF MS.

In this work, the proteomic approach is tested using MALDI-TOF and LC-ESI-Q-TOF mass spectrometry to distinguish six selected fish species (three marine and three freshwater). Samples were digested with trypsin without additional protein extraction before proteomic analysis using both mass spectrometry methods. This approach was successfully used for the preparation of different samples of taxonomical origin (34,35). The obtained data were evaluated using the PostgreSQL database system created in our laboratory, which was accessed using the pgAdmin interface (36). Species-specific markers (m/z values and amino acid sequences) enabling reliable identification of fish were found. The possibility of distinguishing between raw and heat-treated meat is also investigated. The aim is to distinguish between individual species even in the case of heat treatment, and to try to distinguish between raw and heat-treated meat of the same species.

MATERIALS AND METHODS

Reagents and materials

Acetonitrile (ACN) of LC-MS grade, 2,5-dihydroxybenzoic acid (DHB), formic acid (FA) and trifluoroacetic acid (TFA, suitable for HPLC-MS) were purchased from Sigma-Aldrich, Merck (Burlington, MA, USA). Ammonium hydrogen carbonate (AHC, suitable for HPLC-MS) was obtained from Lachema (Brno, Czech Republic). Peptide calibration standard II was purchased from Bruker Daltonics (Bremen, Germany). Pierce trypsin protease MS grade was obtained from Thermo Fisher Scientific (Waltham, MA, USA). The commercially available reverse phase ZipTip C18 pipette tips were purchased from Millipore Corporation (Burlington, MA, USA). The water was purified with a Milli-Q water purification system from Millipore Corporation.

Reference samples of fish meat

The meat from six selected fish species was analysed. Among them were three freshwater species: common carp (Cyprinus carpio), northern pike (Esox lucius), rainbow trout (Oncorhynchus mykiss) and three marine species: Atlantic mackerel (Scomber scombrus), Alaska pollock (Theragra chalcogramma) and Atlantic salmon (Salmo salar). Freshwater fish species were purchased from the local fish store named Štičí líheň ESOX spol. s. r. o. in Tábor (Czech Republic), marine species were from wholesale chains Albert and Lidl. Three individuals of each species (biological replicates) were analysed in this work.

Two types of samples were prepared for each fish: raw and cooked meat. The heat-treated samples were prepared by boiling 1–2 g of cut fish meat in boiling water for 10 min. Both types of samples were then stored in a freezer (-80 °C). These primary samples were later used for the analysis. Three samples (technical replicates) were weighed (approx. 1 mg) for each type of fish. Nine samples of raw meat and nine samples of cooked meat from each fish species were prepared for the analyses.

Sample preparation

A mass of 1 mg of each sample was digested in 20 µL of 50 mM AHC containing 0.02 mg/mL of trypsin at 37 °C with constant shaking for two hours. After two hours, the cleavage was terminated by adding 1 μL of 10 % TFA solution to a final amount of 0.5 % TFA. After the trypsin digestion, the samples were purified and concentrated on reverse phase ZipTip C18. After purification, 10 μL of each purified sample were obtained.

MALDI-TOF MS measurements and data acquisition

A volume of 2 µL of purified peptide sample was mixed with 7.5 µL of DHB matrix solution (8.5 mg of DHB in 0.5 mL of a mixed solvent: water, acetonitrile and 0.1 % TFA). A volume of 1.3 μL of the resulting mixture was spotted thrice on the stainless steel MALDI target and air-dried. Mass spectra were acquired using MALDI-TOF Autoflex Speed mass spectrometer (Bruker Daltonics) equipped with an Nd:YAG laser (355 nm) in positive reflector mode. The obtained spectra contained peaks in the 900–4500 m/z interval. The corresponding spectrum was obtained from a total of 7000 shots for each spot.

LC-ESI-Q-TOF MS conditions and data acquisition

Measurements were carried out using UHPLC Dionex Ultimate3000 RSLC nano (Dionex, Bremen, Germany) connected to ESI-Q-TOF Maxis Impact mass spectrometer (Bruker Daltonics). Purified and air-dried samples (after trypsin digestion, see Sample preparation) were dissolved in 10 μL of a mixture of 3 % acetonitrile and 0.1 % formic acid. A volume of 3 µL of the solution was loaded into an Acclaim PepMap 100 C18 trap column (100 µm×2 cm, size of reverse phase particles 5 µm; Dionex) and 3 % of mobile phase B with a flow rate of 5 µL/min was run for 7 min. The peptides were then eluted from the trap column into Acclaim PepMap RSLC C18 analytical column (75 µm×150 mm, size of reverse phase particles 2 µm; Dionex) using the following gradient: 0–5 min 3 % B, 5–35 min 3–35 % B, 37 min 90 % B, 37–50 min 90 % B, 51 min 3 % B, 51–60 min 3 % B. The mobile phase A consisted of 0.1 % formic acid in water and mobile phase B of 0.1 % formic acid in acetonitrile. The flow rate during gradient separation was set at 0.3 µL/min. The peptides were eluted directly to an ESI source – Captive spray (Bruker Daltonics). Measurements were carried out in positive ion mode with a precursor selection in the range of 400–1400 Da; up to 10 precursors were selected for fragmentation from each MS spectrum.

MS spectrum was recorded every 3 s, MS/MS spectra were collected at 4–16 Hz depending on precursor intensity. Dynamic precursor exclusion was set to 1 min, preferred number of precursor charges was 2–5. Singly charged precursors were excluded from fragmentation. Collision-induced MS/MS spectra were recorded in the range of 50–2200 m/z. Mass spectra were extracted by DataAnalysis 4.1 (Bruker Daltonics) and loaded into Proteinscape 4.2 (Bruker Daltonics) and later into Mascot 2.4.1 (Matrix Science, Boston, MA, USA), which was used for protein identification. The identification was carried out against a single-species database containing the proteome of the investigated species (Cyprinus carpio and Salmo salar were downloaded from the UniProt website on 4 April 2022) (37), which was supplemented with common laboratory contaminants. The following identification parameters were used: enzyme trypsin (one missed cleavage site was allowed), oxidation of methionines as a variable modification, accuracy of assigning precursors of 10 ppm and fragments of 0.05 Da. Identified peptides and proteins were filtered to maintain a false positive identification rate of 1 %. All samples were analysed by LC-ESI-Q-TOF MS in three repetitions to obtain characteristic peptide profiles.

Searching for species-specific markers

To distinguish individual types of fish meat, species-specific markers were identified as m/z or peptides that occurred with certain frequency in the spectra obtained from one species but were absent in the spectra of other fish species. The frequency represents a number of spectra in which the particular m/z values or amino acid sequences occurred. Then these peptides or m/z values can be considered species-specific markers within the selected group of fish. Mass spectra were processed using two complementary methods: MALDI-TOF and LC-ESI-Q-TOF.

For MALDI-TOF data processing, the mMass software, v. 5.5.0 was used (38). The involved spectrum smoothing, baseline correction and manual peak selection, where 80–110 peaks were selected for each MALDI-TOF spectrum. The m/z values from the spectra obtained for a single species were then recorded in Microsoft® Excel® for further analysis.

To manage and analyse the extensive data, we used the PostgreSQL object-relational database system (v. 2022.4.4) with pgAdmin 4 (v. 6.21), an open-source graphical administration tool for PostgreSQL (36). The analysis focused on identifying m/z values that appeared consistently across spectra for each species. This process was adjusted to include only peaks present in a specific frequency, set in this study to a minimum of 23 out of 27 MALDI spectra (three individuals, three technical replicates and three spots per technical repetition).

Similarly, Excel data files containing the results (identified peptides and their corresponding proteins) from LC-ESI-Q-TOF MS were processed using comparable steps. Species-specific peptides were identified as those consistently present in all nine Excel data files corresponding to a single species (three individuals and three technical replicates, where each technical replicate was injected once).

RESULTS AND DISCUSSION

Results of MALDI-TOF mass spectrometry

MALDI-TOF MS measurements were conducted on all six fish species, both raw and cooked samples. This analysis identified m/z values that serve as species-specific markers and characterise each fish species.

Searching for species-specific markers by MALDI-TOF MS

The list of peptides (m/z values) was obtained for each fish species using the data evaluation described in Searching for species-specific markers. The m/z values were determined separately for raw samples across all species and in a separate analysis for cooked samples. In the next step, values were compared between individual species to find characteristic values for one specific species, i.e. a given m/z value that occurred in one species, but not in any other.Table 1 lists the characteristic values for raw and cooked meat samples.Fig. 1 shows the MALDI-TOF MS spectra for carp, pollock and salmon, highlighting the differences in their characteristic m/z values. These spectra serve as a visual representation of some species-specific markers identified in our analysis.

Table 1 Characteristic m/z values for raw and cooked meat of individual types of fish (underlined values are the same for raw and cooked fish meat). The m/z values were determined independently for raw samples across all species and in a separate analysis for cooked samples
Type of meatFish speciesm/z
RawCarp1093.71263.61309.71432.71770.82101.12263.3
Mackerel934.61269.71380.81397.91411.81463.71777.01836.01932.2
2023.22095.22291.42638.64048.3
Pike1226.62587.54165.5
Pollock1142.81325.81564.31632.21800.51866.62221.62553.62635.2
Salmon1868.21980.42059.1
Trout1109.93175.6
CookedCarp1093.71137.51180.51633.61770.82101.12185.02317.12484.2
2732.1
Mackerel934.61050.61115.71239.81269.81296.81308.71380.91397.9
1411.81506.81725.21777.11838.21932.12291.52392.4
Pike1355.92587.52723.73458.34165.5
Pollock1142.91325.91339.01384.01409.11561.21632.21774.61780.7
1800.51866.71890.61895.72221.73183.5
Salmon2059.13291.4
Trout1344.61565.73175.6
Fig. 1 MALDI-TOF MS spectra of: a) salmon (blue), b) carp (red) and c) pollock (green). Characteristic m/z values for raw meat are indicated with asterisk (*)
FTB-63-287-f1

The differentiation of fish species by MALDI-TOF MS using species-specific protein patterns has been shown previously (3942). These studies used a simpler approach without trypsin digestion and analysed extracted proteins directly. Enzymatic cleavage was only used in a subsequent step for the identification of protein biomarker. This method has proven effective for distinguishing species, even without the need for tryptic digestion, particularly for species that are not closely related, such as the six species in our study.

Our approach differs fundamentally in the use of trypsin digestion prior to MALDI-TOF MS measurements. This technique, known as in-sample digestion, fragments proteins into peptides, resulting in spectra with a broader range of information and a higher resolution. While the approach of Mazzeo et al. (39) identified markers in the >11 000 m/z range, corresponding to small proteins like parvalbumins, or Stahl and Schroeder (40), who collected spectra in the mass range 2–20 kDa, our analysis focuses on the 900–4500 Da range to capture differences in the whole proteome rather than targeting specific proteins.

Spielmann et al. (42) explored the use of MALDI-TOF MS for processed meat and developed a database of species-specific fish proteins using the Biotyper tool. While effective, the Biotyper tool is proprietary and requires a paid license, making it less accessible. In contrast, the approach described in this paper utilises PostgreSQL, an open-source database system, which not only reduces costs but also provides broader accessibility to researchers and laboratories.

Although the six tested species could probably be differentiated using simpler methods, this method shows strong potential in the context of heat-treated fish meat, where the higher resolution and broader marker identification provide added value. By focusing on peptide-level markers and leveraging accessible tools, the shown approach offers a cost-effective and innovative alternative for fish meat authentication.

Markers for different types of cooked fish meat were then searched in the same way. In this analysis, at least two specific markers were found for each species. The list of characteristic values of the cooked meat samples is shown inTable 1. A slightly bigger number of characteristic values was found for cooked meat. This can be explained by the fact that proteins in their native structure are not as easily accessible to trypsin cleavage in some positions as the loosened, thermally denatured proteins.

Some m/z values are identical for raw and cooked fish meat. These values can be considered as characteristic markers for the respective species regardless of the type of meat processing (underlined values inTable 1). The other half of the m/z values, which are not the same for raw and cooked meat, proves that some markers differ depending on the type of processing to distinguish the respective species. The obtained results prove the feasibility of the method also for cooked meat and at the same time confirm the stability of some MALDI-TOF MS markers during heat treatment (markers found simultaneously for raw and cooked meat), as mentioned in the literature (39,40).

The next step was to search for markers that could distinguish between raw and heat-treated meat of the same species. In this phase, we therefore focused on the m/z values that differentiate the raw and cooked form of a particular fish—for example, markers unique to raw carp versus cooked carp, and by analogy the other species analysed. The search for markers was carried out sequentially for all analysed species and the results are shown inTable 2. The results show that the raw fish meat samples contained more specific markers than their cooked counterparts. The underlined values represent peaks that are already included inTable 1 and serve as markers for distinguishing between the raw or cooked meat species. These markers have a high discriminatory value and when present in a sample, can determine not only the type of fish meat but also its type (raw or heat treated). Such markers have been found for raw meat of carp, mackerel and pike, in the case of cooked meat of carp and mackerel.

Table 2 Characteristic m/z values for differentiating raw and cooked fish meat of individual fish species (underlined values are usable to characterise the type of fish as well as the type of processing). Only those m/z markers that distinguish the raw and cooked form of the same species—e.g. raw carp versus cooked carp—were considered in this comparison
Fish speciesType of meatm/z
Carpraw1050.61127.71309.81383.71500.81561.91569.9
1877.32480.2
cooked1661.62184.92446.12732.1
Mackerelraw914.51028.61127.71643.91650.92023.22115.1
cooked909.61239.82216.4
Pikeraw1127.71226.81358.91402.8
cooked1279.91908.4
Pollockraw1254.91740.0
cooked1470.0
Salmonraw1002.51050.61067.61127.71269.71296.81339.7
1397.81411.81506.91682.01777.01932.04048.3
cooked1135.51237.61476.71488.71754.81854.72003.0
2384.22512.4
Troutraw1240.81358.81536.11560.01705.0
cooked1400.62118.92406.12438.03414.63471.7

Results from LC-ESI-Q-TOF mass spectrometry

The LC-ESI-Q-TOF analyses were performed only on carp and salmon samples, both raw and cooked (a total of 36 samples were analysed – nine for each type of processing of these species). The reason for this was that in the used UniProt protein database (in which the peptides and proteins are searched) the fish species category is not complete. Therefore, only the two species whose protein sequences are available in the database were selected. This method can detect the amino acid sequences of peptide fragments and identify the protein from which the fragments originate. This provides more accurate data than the m/z values usually obtained by MALDI-TOF MS.

Identified proteins

Over 100 proteins (100–150) detected based on at least two peptides (with a length from 7 to 30 amino acids) were identified in each sample. The same proteins were mostly identified in cooked and raw meat of the same species, but the number of peptides found differed between them, which again indicates slightly different cleavage of the heat-treated proteins by trypsin.Table 3 shows selected identified proteins in raw and cooked carp meat. Similarly,Table 4 shows the proteins found in salmon.

Table 3 Selected proteins identified in raw and cooked carp meat
Access codeProteinN(peptide)
rawcooked
A0A8C1U661Myosin heavy chain, fast skeletal muscle-like124±9122±9
A0A8C2BNT8Myosin, heavy chain b65±460±6
A0A8C1U0K1Nebulin59±986±17
A0A8C1WNY8ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1, like35±238±5
A0A8C1N3F8Creatine kinase M-type35±337±3
A0A8C1T5E4Actin alpha 1, skeletal muscle33±436±4
A0A8C1X499Actinin alpha 3b31±332±3
A0A8C1USJ2Phosphorylase, glycogen, muscle A29±429±5
A0A8C1V0Y0Myosin regulatory light chain 2, skeletal muscle isoform-like25±2-
A0A2U9IYA4Fructose-bisphosphate aldolase23±323±4
A0A8C1J152Myosin light chain 3, skeletal muscle isoform-like22±316±2
A0A8C1FTE8Alpha-tropomyosin22±119±3
A0A8C1W232Myosin light chain 1, skeletal muscle isoform-like17±2-
A0A8C1TSP1EF-hand calcium binding domain 716±3-
A0A8C1S5P5Calsequestrin 1a8±1-
A0A8C1RRE4Glyceraldehyde-3-phosphate dehydrogenase-24±2
A0A8C1S397Enolase 3 (beta, muscle)-19±5
A0A8C1ZWS8Myosin binding protein C, fast type b-19±2
Q8UUS2Parvalbumin-10±1

Data are presented as mean value±S.D. N(peptide)=average number of peptides across all analysed samples, N(repetition)=9

Table 4 Selected proteins identified in raw and cooked salmon meat
Access codeProteinN(peptide)
rawcooked
A0A1S3QIW0Myosin heavy chain, fast skeletal muscle-like156±16156±13
A0A1S3NZ45Titin-like137±1583±18
A0A1S3NZK3Nebulin isoform X1167±890±17
B5DG55Alpha-1,4 glucan phosphorylase60±535±4
A0A1S3NEY1Calcium-transporting ATPase38±436±5
A0A1S3SB73Actin, alpha cardiac36±634±7
B5DGP2Creatine kinase28±326±3
A0A1S2WZE0Fructose-bisphosphate aldolase28±532±5
B5DGR3Glyceraldehyde-3-phosphate dehydrogenase27±429±3
Q91472Fast myotomal muscle tropomyosin25±4-
B5DGU1Pyruvate kinase25±226±4
A0A1S3LCK1ATP-dependent 6-phosphofructokinase24±319±3
Q7ZZN0Myosin regulatory light chain 221±319±2
A0A1S3P5Q0Triosephosphate isomerase20±1-
A0A1S3QZX8Glycogen debrancher18±5-
A0A1S2WZE32-phospho-d-glycerate hydro-lyase-33±4
A0A1S3NGD5Myosin-binding protein C, fast-type-like-29±5
B5DG39l-lactate dehydrogenase-13±2

Data are presented as mean value±S.D. N(peptide)=average number of peptides across all analysed samples, N(repetition)=9

The proteins with the largest number of identified peptides include myofibrillar proteins, which are most abundant in fish muscles: myosin, actin, nebulin, titin and tropomyosin. All proteins from this group are involved in a process of muscle contraction, for which they either directly provide or fulfil a regulatory function.

A large number of proteins from the second most represented group of proteins in fish meat were detected, namely sarcoplasmic proteins. Mainly enzymes belonging to the group of these water-soluble proteins were identified, i.e. creatine kinase (EC 2.7.3.2), glycogen phosphorylase (EC 2.4.1.1), SERCA (sarco/endoplasmic reticulum Ca2+ ATPase; EC 7.2.2.10), fructose-1,6-bisphosphate-aldolase (EC 4.1.2.13), glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.12), pyruvate kinase (EC 2.7.1.40), lactate dehydrogenase (EC 1.1.1.27) and phosphofructokinase (EC 2.7.1.11). Other sarcoplasmic proteins such as myoglobin, α- and β-subunits of haemoglobin and parvalbumin were found. Parvalbumin is an important sarcoplasmic protein used for the authentication of fish meat and it is the main allergen of fish meat.

The third group of very little represented stromal proteins was represented by two types of collagens, type I and VI. In carp and salmon, significantly more peptides deriving from collagen were found in cooked meat.

Searching for characteristic peptide sequences

Evaluation of the LC-ESI-Q-TOF data against the UniProt database also enables a closer look at the peptide fragments. The found specific sequences of peptide fragments were analysed (similarly to the search for MALDI-TOF m/z markers) by the program pgAdmin 4, which works with the PostgreSQL database system (see Searching for species-specific markers).

Distinguishing between carp and salmon

The raw carp and salmon samples were evaluated separately from the cooked ones using the identical procedure. Firstly, the software tool pgAdmin 4 was used to determine which peptides were found in all samples of a species (i.e. nine samples: three biological individuals of a species and three technical replicates prepared from each individual). Then, the characteristic sequences for the respective species were determined, which were found in all samples of one species and at the same time in none of the samples of the other species. These characteristic sequences were approx. 400 for carp and 550 for salmon in the raw meat and approx. 400 sequences for carp and 600 for salmon in the cooked meat. At this point it is important to emphasise that "characteristic" in this case means specific only to the other compared species, i.e. sequences of carp are characteristic compared to salmon and vice versa. This is a proposal of a new method that could be used to identify fish meat after obtaining the measured data from a sufficient number of fish species. The results obtained for carp and salmon show that this method of identification can work. The advantage over MALDI-TOF MS is that it is possible to determine the specific peptide sequences responsible for differentiating the fish species and to identify the protein of origin from which these peptides originate.

The most important proteins for differentiating the species can be determined based on the number of found characteristic sequences.Table 5 shows the five proteins with the largest number of characteristic sequences for raw and cooked salmon and carp meat.

Table 5 Proteins containing the most species-characteristic sequences in raw and cooked carp and salmon samples
FishAccess codeProteinN(characteristic sequence)
rawcooked
CarpA0A8C1U661Myosin heavy chain, fast skeletal muscle-like6250
CarpA0A8C2BNT8Myosin, heavy chain b3224
CarpA0A8C1U0K1Nebulin2633
CarpA0A2U9IYA4Fructose-bisphosphate aldolase19-
CarpA0A8C1WNY8Calcium-transporting ATPase1916
CarpA0A8C1N3F8Creatine kinase M-type-20
SalmonA0A1S3QIW0Myosin heavy chain, fast skeletal muscle-like9086
SalmonA0A1S3NZ45Titin-like8659
SalmonB5DG55Alpha-1,4 glucan phosphorylase37-
SalmonB5DGP2Creatine kinase3130
SalmonA0A1S3NZK3Nebulin isoform X113044
SalmonA0A1S2WZE32-phospho-d-glycerate hydro-lyase-20

In raw carp samples, significantly more characteristic sequences originated from glycogen phosphorylase (10) than in cooked ones (4). Some proteins did not provide any characteristic sequences in the cooked carp meat samples – for example, the ryanodine receptor (a receptor associated with calcium channels) or the enzyme malate dehydrogenase. Both proteins had two characteristic sequences in the raw carp samples. The raw salmon meat contained more characteristic sequences for the enzymes phosphoglucomutase (8 versus 3) and glycogen debranching enzyme (8 versus 2) than the cooked meat.

On the contrary, cooked carp and salmon samples contained significantly more characteristic sequences originating from two proteins: parvalbumin and collagen. These two proteins were of great importance in distinguishing the cooked species (altogether around 20 characteristic sequences), while only two characteristic sequences from parvalbumin and one from collagen were found in raw salmon and none from these two proteins in the raw carp. In carp, 11 characteristic sequences of glyceraldehyde-3-phosphate dehydrogenase can be used for distinguishing cooked meat, but not a single one for distinguishing raw meat. Similarly, lactate dehydrogenase contains four characteristic sequences for distinguishing cooked meat, but none for raw meat. However, unlike parvalbumin and collagen, the same situation was not observed for these two enzymes in salmon samples.

Distinguishing between carp and salmon including the type of meat processing

Finally, an attempt was made to analyse the characteristic sequences including the type of processing (raw carp and salmon were compared simultaneously with their cooked meat). Only a few characteristic sequences specific to each sample type (e.g. raw carp) were identified: 17 characteristic sequences for raw carp, 40 for cooked carp, 10 for raw salmon and only 5 for cooked salmon. These markers in the form of characteristic sequences provide discriminatory value as they meet strict criteria: a given characteristic sequence is present in all nine samples of one material (e.g. raw carp), but it is not found in a single sample of the other materials (cooked carp, raw and cooked salmon). The characteristic sequences for each fish can be found in Supplementary material (Tables S1–S4{ label needed for table-wrap[@id='tS.2'] }{ label needed for table-wrap[@id='tS.3'] }{ label needed for table-wrap[@id='tS.4'] }).

Seven of the 40 characteristic sequences for cooked carp originated from parvalbumin, which demonstrates the two reported properties of parvalbumins: its interspecies variability and its thermostability. Owing to the interspecies variability, it is possible to distinguish between carp and salmon, and thanks to the thermostability, it is possible to find parvalbumin fragments in cooked meat. Another seven of the 40 characteristic sequences for cooked carp originate from glyceraldehyde-3-phosphate dehydrogenase. Characteristic sequences originally belonging to collagen were found in both cooked carp and salmon samples.

Comparison of markers found by both mass spectrometric methods

A possible similarity between markers found with MALDI-TOF and LC-ESI-Q-TOF mass spectrometry was investigated. The m/z markers obtained from MALDI-TOF MS (seeTable 1 andTable 2) were compared to the list of the characteristic peptide sequences (their m/z) obtained by LC-ESI-Q-TOF.

Since MALDI produce ions of peptides and proteins with a uniform charge of +1 and the ions generated by electrospray ionization can have multiple charges, it was not possible to directly compare the m/z values obtained by these two methods. The molecular mass of the peptide fragments were compared after charge subtraction. For MALDI-TOF, these values were easily obtained by subtracting the mass of one proton (MH+=1 Da), for LC-ESI-Q-TOF the mass of the peptide fragment was obtained directly from the results exported by Mascot 2.4.1. The tolerance was set to ±0.3 Da. Seven and three characteristic MALDI-TOF MS markers were obtained for raw carp and salmon samples respectively (seeTable 1). Of these, three values for carp and none for salmon were found in the LC-ESI-Q-TOF markers in the form of characteristic sequences within the required tolerance. An overview of these values can be found inTable 6.

Table 6 Comparison of similarity of found markers between both mass spectrometric methods for raw and cooked meat samples of carp
Type of meatSpeciesM(fragment/Da)PeptideProtein
MALDI-TOFLC-ESI-Q-TOF
RawCarp1092.71092.56K.GFTLPTTNSR.GCreatine kinase, muscle b
Carp1262.61262.64K.VAFNQVADIMR.ALanC synthetase component C-like
Carp1308.71308.68R.IDFDAFLPMLK.SMyosin light chain 3, skeletal muscle isoform
CookedCarp1092.71092.56K.GFTLPTTNSR.GCreatine kinase, muscle b
Carp1136.51136.61K.NALAHAVQSAR.HMyosin heavy chain, fast skeletal muscle
Carp1179.51179.55R.LQTENGEFSR.QMyosin heavy chain, fast skeletal muscle
Carp2184.02184.03K.GILGYTEDQVVST
DFNGDVR.S
Glyceraldehyde-3-phosphate dehydrogenase

In cooked samples of the same fish species, 10 markers for carp and two for salmon were obtained using the MALDI-TOF method (seeTable 2). Within the same tolerance, four out of ten carp markers were also found in the LC-ESI-Q-TOF data. However, not a single match was found for salmon.

CONCLUSIONS

Using MALDI-TOF MS, species-specific markers were identified for each species in the form of characteristic m/z values. Additionally, markers that differentiate between raw and cooked meat of the same species were determined. Six markers with a high discriminatory power were found for carp, mackerel and pike, which would determine the type of processing (raw or cooked) in addition to species identification.

Only carp and salmon samples (raw and cooked meat) were analysed with LC-ESI-Q-TOF. A large number of species-specific amino acid sequences were found: in raw samples about 400 for carp and 550 for salmon, in cooked samples about 400 sequences for carp and 600 for salmon. The most characteristic sequences came from myosin, actin, nebulin, titin and sarcoplasmic enzymes. Both raw and cooked carp and salmon samples were included in the search for characteristic sequences. In this case, only a few dozen of characteristic sequences were identified for the given fish species and the method of meat preparation (e.g. for raw carp meat).

Since one of the most common types of adulteration of fish meat in general is species substitution, when meat of a more expensive species is replaced by meat of a cheaper species, the results of this work can be applied in food analysis. The identified species-specific markers have potential use in the assessment of the authenticity and taxonomic origin of fish products to ensure adequate quality and safety, especially in cases where morphological characteristics are lost during the processing of fish meat, or DNA and protein are degraded due to high temperatures during cooking.

ACKNOWLEDGEMENTS

We are indebted to Ing. Jiri Santrucek, PhD, from the University of Chemistry and Technology, Prague, Czech Republic, for his invaluable technical assistance with LC-MS/MS.

Notes

[1] Financial disclosure FUNDING

This work was supported by the grant of Specific university research (the University of Chemistry and Technology, Prague, Czech Republic), grant No. A1_FPBT_2024_001 and A2_FPBT_2024_017.

[2] Conflicts of interest CONFLICT OF INTEREST

The authors have declared no conflict of interest.

SUPPLEMENTARY MATERIAL

Supplementary materials are available at:www.ftb.com.hr.

REFERENCES

1 

Miller DD, Sumaila UR. IUU Fishing and Impact on the Seafood Industry. In: Naaum AM, Hanner RH, editors. Seafood Authenticity and Traceability. Cambridge, USA: Academic Press; 2016. pp. 83-95. https://doi.org/10.1016/B978-0-12-801592-6.00004-8

2 

Maestri E, Marmiroli N. Advances in polymerase chain reaction technologies for food authenticity testing. In: Downey G, editor. Advances in food authenticity testing. Cambridge, UK: Woodhead Publishing; 2016. pp. 285-309. https://doi.org/10.1016/B978-0-08-100220-9.00011-4

3 

Acutis PL, Cambiotti V, Riina MV, Meistro S, Maurella C, Massaro M, et al. Detection of fish species substitution frauds in Italy: A targeted National Monitoring Plan. Food Control. 2019;101:151–5. https://doi.org/10.1016/j.foodcont.2019.02.020

4 

Sharrad AE, Reis-Santos P, Austin J, Gillanders BM. Umbrella terms conceal the sale of threatened shark species: A DNA barcoding approach. Food Control. 2023;148:109606. https://doi.org/10.1016/j.foodcont.2023.109606

5 

Alikord M, Momtaz H, Keramat J, Kadivar M, Homayouni A. Species identification and animal authentication in meat products: a review. J Food Meas Charact. 2018;12(1):145–55. https://doi.org/10.1007/s11694-017-9625-z

6 

Kumar A, Kumar RR, Sharma BD, Gokulakrishnan P, Mendiratta SK, Sharma D. Identification of species origin of meat and meat products on the DNA basis: A review. Crit Rev Food Sci Nutr. 2015;55(10):1340–51. https://doi.org/10.1080/10408398.2012.693978 PubMed: http://www.ncbi.nlm.nih.gov/pubmed/24915324

7 

Loh WKW, Bond P, Ashton KJ, Roberts DT, Tibbetts IR. DNA barcoding of freshwater fishes and the development of a quantitative qPCR assay for the species‐specific detection and quantification of fish larvae from plankton samples. J Fish Biol. 2014;85(2):307–28. https://doi.org/10.1111/jfb.12422 PubMed: http://www.ncbi.nlm.nih.gov/pubmed/24963726

8 

Hindson BJ, Ness KD, Masquelier DA, Belgrader P, Heredia NJ, Makarewicz AJ, et al. High-throughput droplet digital PCR system for absolute quantitation of DNA copy number. Anal Chem. 2011;83(22):8604–10. https://doi.org/10.1021/ac202028g PubMed: http://www.ncbi.nlm.nih.gov/pubmed/22035192

9 

Doi H, Takahara T, Minamoto T, Matsuhashi S, Uchii K, Yamanaka H. Droplet digital polymerase chain reaction (PCR) outperforms real-time PCR in the detection of environmental DNA from an invasive fish species. Environ Sci Technol. 2015;49(9):5601–8. https://doi.org/10.1021/acs.est.5b00253 PubMed: http://www.ncbi.nlm.nih.gov/pubmed/25850372

10 

Cao W, Li Y, Chen X, Chang Y, Li L, Shi L, et al. Species identification and quantification of silver pomfret using the droplet digital PCR assay. Food Chem. 2020;302:125331. https://doi.org/10.1016/j.foodchem.2019.125331 PubMed: http://www.ncbi.nlm.nih.gov/pubmed/31404867

11 

Noh ES, Park YJ, Kim EM, Park JY, Shim KB, Choi TJ, et al. Quantitative analysis of Alaska pollock in seafood products by droplet digital PCR. Food Chem. 2019;275:638–43. https://doi.org/10.1016/j.foodchem.2018.09.093 PubMed: http://www.ncbi.nlm.nih.gov/pubmed/30724244

12 

Bossier P. Authentication of seafood products by DNA patterns. J Food Sci. 1999;64(2):189–93. https://doi.org/10.1111/j.1365-2621.1999.tb15862.x

13 

Dooley JJ, Sage HD, Clarke MAL, Brown HM, Garrett SD. Fish species identification using PCR− RFLP analysis and lab-on-a-chip capillary electrophoresis: application to detect white fish species in food products and an interlaboratory study. J Agric Food Chem. 2005;53(9):3348–57. https://doi.org/10.1021/jf047917s PubMed: http://www.ncbi.nlm.nih.gov/pubmed/15853371

14 

Murugaiah C, Noor ZM, Mastakim M, Bilung LM, Selamat J, Radu S. Meat species identification and Halal authentication analysis using mitochondrial DNA. Meat Sci. 2009;83(1):57–61. https://doi.org/10.1016/j.meatsci.2009.03.015 PubMed: http://www.ncbi.nlm.nih.gov/pubmed/20416658

15 

Aranishi F, Okimoto T, Izumi S. Identification of gadoid species (Pisces, Gadidae) by PCR-RFLP analysis. J Appl Genet. 2005;46(1):69–73. PubMed: http://www.ncbi.nlm.nih.gov/pubmed/15741666

16 

Lin WF, Hwang DF. Application of PCR-RFLP analysis on species identification of canned tuna. Food Control. 2007;18(9):1050–7. https://doi.org/10.1016/j.foodcont.2006.07.001

17 

Kim YK, Lee CH, Lee YD, Han SH. Development of species-specific PCR for the identification of three grouper fish species (Epinephelus septemfasciatus, E. bruneus and E. akaara). Indian J Anim Res. 2017;53(4):482–4. https://doi.org/10.18805/ijar.v0iOF.8488

18 

Durand JD, Diatta MA, Diop K, Trape S. Multiplex 16S rRNA haplotype‐specific PCR, a rapid and convenient method for fish species identification: An application to West African Clupeiform larvae. Mol Ecol Resour. 2010;10(3):568–72. https://doi.org/10.1111/j.1755-0998.2009.02776.x PubMed: http://www.ncbi.nlm.nih.gov/pubmed/21565060

19 

Bojolly D, Doyen P, Le Fur B, Christaki U, Verrez-Bagnis V, Grard T. Development of a qPCR method for the identification and quantification of two closely related tuna species, bigeye tuna (Thunnus obesus) and yellowfin tuna (Thunnus albacares), in canned tuna. J Agric Food Chem. 2017;65(4):913–20. https://doi.org/10.1021/acs.jafc.6b04713 PubMed: http://www.ncbi.nlm.nih.gov/pubmed/28085274

20 

Hulley EN, Tharmalingam S, Zarnke A, Boreham DR. Development and validation of probe-based multiplex real-time PCR assays for the rapid and accurate detection of freshwater fish species. PLoS One. 2019;14(1):e0210165. https://doi.org/10.1371/journal.pone.0210165 PubMed: http://www.ncbi.nlm.nih.gov/pubmed/30699146

21 

Regulatory Fish Encyclopedia (RFE). Silver Spring, MD, USA: US Food and Drug Administration; 2024. Available from:https://www.fda.gov/food/reference-databases-and-monitoring-programs-food/regulatory-fish-encyclopedia-rfe.

22 

Taylor WJ, Jones JL. An immunoassay for verifying the identity of canned sardines. Food Agric Immunol. 1992;4(3):169–75. https://doi.org/10.1080/09540109209354765

23 

Céspedes A, García T, Carrera E, González I, Fernández A, Asensio L, et al. Indirect enzyme-linked immunosorbent assay for the identification of sole (Solea solea), European plaice (Pleuronectes platessa), flounder (Platichthys flesus), and Greenland halibut (Reinhardtius hippoglossoides). J Food Prot. 1999;62(10):1178–82. https://doi.org/10.4315/0362-028X-62.10.1178 PubMed: http://www.ncbi.nlm.nih.gov/pubmed/10528723

24 

Huang TS, Marshall MR, Kao KJ, Otwell WS, Wei CI. Development of monoclonal antibodies for red snapper (Lutjanus campechanus) identification using enzyme-linked immunosorbent assay. J Agric Food Chem. 1995;43(8):2301–7. https://doi.org/10.1021/jf00056a063

25 

Asensio L, González I, Rodríguez MA, Mayoral B, López-Calleja I, Hernández PE, et al. Identification of grouper (Epinephelus guaza), wreck fish (Polyprion americanus), and Nile perch (Lates niloticus) fillets by polyclonal antibody-based enzyme-linked immunosorbent assay. J Agric Food Chem. 2003;51(5):1169–72. https://doi.org/10.1021/jf026020x PubMed: http://www.ncbi.nlm.nih.gov/pubmed/12590451

26 

Piñeiro C, Barros‐Velázquez J, Pérez‐Martín RI, Martínez I, Jacobsen T, Rehbein H, et al. Development of a sodium dodecyl sulfate‐polyacrylamide gel electrophoresis reference method for the analysis and identification of fish species in raw and heat‐processed samples: A collaborative study. Electrophoresis. 1999;20(7):1425–32. https://doi.org/10.1002/(SICI)1522-2683(19990601)20:7<1425::AID-ELPS1425>3.0.CO;2-R PubMed: http://www.ncbi.nlm.nih.gov/pubmed/10424465

27 

Rehbein H, Kündiger R, Yman IM, Ferm M, Etienne M, Jerome M, et al. Species identification of cooked fish by urea isoelectric focusing and sodium dodecylsulfate polyacrylamide gel electrophoresis: a collaborative study. Food Chem. 1999;67(4):333–9. https://doi.org/10.1016/S0308-8146(99)00175-2

28 

Etienne M, Jérôme M, Fleurence J, Rehbein H, Kündiger R, Mendes R, et al. Identification of fish species after cooking by SDS−PAGE and urea IEF: A collaborative study. J Agric Food Chem. 2000;48(7):2653–8. https://doi.org/10.1021/jf990907k PubMed: http://www.ncbi.nlm.nih.gov/pubmed/10898602

29 

Martinez I, Jakobsen Friis T. Application of proteome analysis to seafood authentication. Proteomics. 2004;4(2):347–54. https://doi.org/10.1002/pmic.200300569 PubMed: http://www.ncbi.nlm.nih.gov/pubmed/14760704

30 

Berrini A, Tepedino V, Borromeo V, Secchi C. Identification of freshwater fish commercially labelled “perch” by isoelectric focusing and two-dimensional electrophoresis. Food Chem. 2006;96(1):163–8. https://doi.org/10.1016/j.foodchem.2005.04.007

31 

Osman MA, Ashoor SH, Marsh PC. Liquid chromatographic identification of common fish species. J AOAC Int. 1987;70(4):618–25. https://doi.org/10.1093/jaoac/70.4.618

32 

Chou CC, Lin SP, Lee KM, Hsu CT, Vickroy TW, Zen JM. Fast differentiation of meats from fifteen animal species by liquid chromatography with electrochemical detection using copper nanoparticle plated electrodes. J Chromatogr B Analyt Technol Biomed Life Sci. 2007;846(1-2):230–9. https://doi.org/10.1016/j.jchromb.2006.09.006 PubMed: http://www.ncbi.nlm.nih.gov/pubmed/17008137

33 

Volta P, Riccardi N, Lauceri R, Tonolla M. Discrimination of freshwater fish species by matrix-assisted laser desorption/ionization-time of flight mass spectrometry (MALDI-TOF MS): A pilot study. J Limnol. 2012;71(1):164–9. https://doi.org/10.4081/jlimnol.2012.e17

34 

Kuckova S, Zitkova K, Novotny O, Smirnova T. Verification of cheeses authenticity by mass spectrometry. J Sep Sci. 2019;42(22):3487–96. https://doi.org/10.1002/jssc.201900659 PubMed: http://www.ncbi.nlm.nih.gov/pubmed/31549465

35 

Kuckova S, Meledina A, Zitkova K, Oltrogge D, Fuchs R, Hynek R. The influence of colouring materials and artificial ageing on the occurrence of nonspecific peptides in protein binders. Microchem J. 2022;177:107258. https://doi.org/10.1016/j.microc.2022.107258

36 

Kirg R, Kuckova S. Návod na instalaci a nalezení unikátních hodnot m/z pro metody MALDI-TOF a LC-MS/MS (Instructions for the installation and identification of unique m/z values for MALDI-TOF and LC-MS/MS methods). Internal laboratory material. The University of Chemistry and Technology, Prague, Czech Republic; 2021 (in Czech).

37 

The UniProt Consortium. UniProt: The universal protein knowledgebase in 2021. Nucleic Acids Res. 2021;49 D1:D480–9. https://doi.org/10.1093/nar/gkaa1100 PubMed: http://www.ncbi.nlm.nih.gov/pubmed/33237286

38 

mMass, v. 5.5.0, Martin Strohalm, Free Software Foundation, Prague, Czech Republic; 2005-2013. Available from:https://github.com/xxao/mMass.

39 

Mazzeo MF, De Giulio B, Guerriero G, Ciarcia G, Malorni A, Russo GL, et al. Fish authentication by MALDI-TOF mass spectrometry. J Agric Food Chem. 2008;56(23):11071–6. https://doi.org/10.1021/jf8021783 PubMed: http://www.ncbi.nlm.nih.gov/pubmed/19007297

40 

Stahl A, Schröder U. Development of a MALDI–TOF MS-based protein fingerprint database of common food fish allowing fast and reliable identification of fraud and substitution. J Agric Food Chem. 2017;65(34):7519–27. https://doi.org/10.1021/acs.jafc.7b02826 PubMed: http://www.ncbi.nlm.nih.gov/pubmed/28745053

41 

Böhme K, Calo-Mata P, Barros-Velázquez J, Ortea I. Recent applications of omics-based technologies to main topics in food authentication. Trends Analyt Chem. 2019;110:221–32. https://doi.org/10.1016/j.trac.2018.11.005

42 

Spielmann G, Huber I, Maggipinto M, Haszprunar G, Busch U, Pavlovic M. Comparison of five preparatory protocols for fish species identification using MALDI-TOF MS. Eur Food Res Technol. 2018;244(4):685–94. https://doi.org/10.1007/s00217-017-2983-2

Appendices

Table S1 Characteristic peptides for raw carp samples
Protein originPeptidem/z
Actinin alpha 3a; Actinin alpha 3b; Alpha-actinin-3R.FAIQDISVEETSAK.E769.39
A kinase (PRKA) anchor protein 12bK.EESQAESKAEPK.V666.82
Alpha-tropomyosin; Tropomyosin alpha-1 chain-like; Tropomyosin alpha-1 chain-likeK.DAQEKLELAEK.K637.33
ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transportingK.FTLEFSR.D450.23
ATP citrate lyase bK.LSTIEFK.S419.24
Phosphorylase, glycogen, muscle AR.HLEIIYEINRR.H485.94
EF-hand calcium binding domain 7R.DIFDFAALK.E520.27
K.AIGGIILTASHNPGGPSGDFGIK.F727.05
Glycogen debranching enzyme-likeR.VLDWINPTGR.E585.81
Malate dehydrogenase 2, NAD (mitochondrial)R.FTFSLLDAMNGK.E672.33
Myosin heavy chain, fast skeletal muscle-like; Myosin, heavy chain bK.SRVTFQLSAER.S647.34
SH3 domain binding glutamate-rich proteinK.QQDVVGFLEALK.I673.87
Uncharacterized proteinK.TLITDTVFK.I519.30
Uncharacterized protein-.MLMSHLEEPK.L623.79
Uncharacterized proteinR.LNVSSTVTSTVLK.I674.89
Uncharacterized proteinR.YFLTLENVTGSK.T686.36
Uncharacterized proteinR.YSVTGLETGAEYK.F709.34
{ label needed for table-wrap[@id='tS.2'] }
Table S2 Characteristic peptides for cooked carp samples
Protein originPeptidem/z
Adenosine monophosphate deaminase 1 (isoform M)K.LAGWFNK.H418.23
Adenylate kinase isoenzyme 1K.IGAPALLLYIDAKAETMVQR.L725.07
Calsequestrin 1aK.SQKSEHYQEYEDAAEEFHPHIK.F676.31
Glucose-6-phosphate isomerase bK.ILVANFLAQTEALMK.G831.46
K.SITDVVNVGIGGSDLGPLMVTEALKPYSK.G987.52
Glyceraldehyde-3-phosphate dehydrogenaseK.VIHDNFVIIEGLMSTVHAITATQK.T660.10
R.VCDLMAHMASKE.-667.80
R.VIISAPSADAPMFVMGVNHEKYDNSLK.V734.12
R.VIISAPSADAPMFVMGVNHEK.Y738.37
K.WGDAGANYVVESTGVFTTIEK.A748.70
R.SSIFDAGAGIALNDHFVK.L931.47
K.AAADGPMKGILGYTEDQVVSTDFNGDVR.S976.13
Collagen, type I, alpha 2R.GNPGPAGALGAQGPIGNR.G802.42
R.GPIGNIGMPGMTGPQGEAGR.E956.95
R.GPLGNIGMPGMTGPQGEAGR.E956.95
Creatine kinase, mitochondrial 2a (sarcomeric)K.TVGMVAGDEESYEVFAEIFDPVIKDR.H972.80
Creatine kinase, muscle bK.DIYNKLR.S461.26
K.GFTLPTTNSRGER.R479.25
K.VLTKDIYNK.L547.32
Enolase 3, (beta, muscle)K.FTGSVDIQVVGDDLTVTNPK.R1053.04
Myomesin 1a (skelemin)K.SDDVLIFDIGK.I611.32
Myomesin 1bK.ATNQSSLVLIGDVFK.Q796.43
Myomesin 2aR.FVVHGLVPGDTYVFR.V569.30
Myosin binding protein HbK.VNLVVPFSGKPQPVVSWTK.D694.73
Myosin heavy chain, fast skeletal muscle-likeR.TLEDQLSEIKTK.S702.88
R.ARLQTENGEFSR.Q704.35
NebulinR.SDAVYKADLEWIR.G522.60
R.DIASDYKYK.L551.77
Parvalbumin-2-likeK.SGFIEEDELKLFLQNFAAGAR.A785.73
Parvalbumin-7-like;
Parvalbumin 7
K.FFDVVGLK.A462.76
K.IGIDEFEALVHE.-686.34
Parvalbumin beta-like; ParvalbuminK.AFAIIDQDK.S510.77
K.IGVDEFTALVK.A596.33
K.AFAIIDQDKSGFIEEDELK.L723.36
K.AFAIIDQDNSGFIEEEELKLFLQNFK.A765.39
Pyruvate kinase M1/2bK.TTGSAFIQTQQMHAAMAETLLEHLCLLDIDSEPTVSR.N1015.24
Rhotekin 2aR.NIATRSTVSSCSSLAMEIK.R500.26
Triosephosphate isomerase 1bK.FFVGGNWK.L477.74
Troponin C type 2 (fast)K.AAFDMFDTDGGGDISTKELGTVMR.M845.38
Uncharacterized proteinK.AGTKIELPADITGKPEPK.V467.01
{ label needed for table-wrap[@id='tS.3'] }
Table S3 Characteristic peptides for raw salmon samples
Protein originPeptidem/z
Alpha-1,4 glucan phosphorylaseR.HLEIIYEINRR.F485.94
ATP-dependent 6-phosphofructokinaseR.TFILEVMGR.H533.29
Glycerol-3-phosphate dehydrogenaseK.NIVAVGAGFCDGLGFGDNTK.A977.97
Malate dehydrogenaseR.FTFSVLDAMNGK.E665.33
Myosin-7-likeM.EGDLNEMEIQLSHSNR.Q624.62
-.MEGDLNEMEIQLSHSNR.Q673.63
Myosin-binding protein C, fast-type-likeK.LLDDYHVVVGER.V472.25
Titin-likeR.FSLTIFR.A442.25
R.VLDSPSMPANFAIK.E745.38
TSC22 domain family protein 3-.MSTEIFK.T428.22
{ label needed for table-wrap[@id='tS.4'] }
Table S4 Characteristic peptides for cooked salmon samples
Protein originPeptidem/z
AnnexinR.SLLLALVQAK.R528.34
Collagen alpha-3(VI) chain-like isoform X1; Collagen alpha-3(VI) chain-like isoform X2; Collagen alpha-3(VI) chain-like;
Collagen alpha-3(VI) chain-like
R.SQEGVPQMLILLSGGR.S562.30
Protein S100K.DLLNAELGEIMGK.N701.86
Troponin C, skeletal muscleK.NADGMLDFDEFLK.M757.84
Voltage-dependent anion-selective channel protein 3; Voltage-dependent anion-selective channel protein 3K.LTLSALIDGK.N515.81

This display is generated from NISO JATS XML with jats-html.xsl. The XSLT engine is libxslt.